Protein Info for PP_1980 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01643: Acyl-ACP_TE
  • amino acids 15 to 137 (123 residues), 24.2 bits, E=3.7e-09
• PF13279: 4HBT_2
  • amino acids 16 to 134 (119 residues), 58.5 bits, E=1.5e-19
• PF03061: 4HBT
  • amino acids 24 to 86 (63 residues), 37.6 bits, E=3.4e-13

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 97% identity to ppw:PputW619_1543)

Predicted SEED Role

"FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein"

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See Q88LF3 at UniProt or InterPro

Protein Sequence (144 amino acids)

>PP_1980 conserved protein of unknown function (Pseudomonas putida KT2440)
MSWDLATPFVIDLRVGSEDIDGLGHANNAVYVTWLERCAWRHSQRLGLDLAEYRRLDRAM
AVVRHEIDYLAAAYEDDELQLATWIIDWDQRLRMTRRFQLKRPRDGVTLLRAQTTFACIE
LSSGKPRRMPAEFVEGYGPALIGA