Protein Info for PP_1968 in Pseudomonas putida KT2440

Annotation: TetR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 157 to 173 (17 residues), see Phobius details PF00440: TetR_N" amino acids 18 to 63 (46 residues), 58.1 bits, see alignment 6e-20 PF13305: TetR_C_33" amino acids 87 to 194 (108 residues), 30.6 bits, see alignment E=4.6e-11

Best Hits

KEGG orthology group: None (inferred from 98% identity to ppw:PputW619_1534)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LG5 at UniProt or InterPro

Protein Sequence (211 amino acids)

>PP_1968 TetR family transcriptional regulator (Pseudomonas putida KT2440)
MQKEPRKVREFRRREQEILDTALKLFLEQGEDSVTVEMIADAVGIGKGTIYKHFKSKAEI
YLRLMLDYERDLNELLHSADVDRDKEALSRAYFEFRMRDPQRYRLFDRLEEKVVKGNQVP
EMVEQLHSIRASNFDRLTQLIKGRISEGKLEDVPPYFHYCAAWALVHGAVALYHSPFWSN
VLEDQEGFFQFLMDIGVRMGNKRKRDPEPSN