Protein Info for PP_1966 in Pseudomonas putida KT2440

Annotation: DNA polymerase III subunit delta'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF13177: DNA_pol3_delta2" amino acids 11 to 162 (152 residues), 162.4 bits, see alignment E=1.4e-51 TIGR00678: DNA polymerase III, delta' subunit" amino acids 12 to 198 (187 residues), 212 bits, see alignment E=2.7e-67 PF00004: AAA" amino acids 25 to 160 (136 residues), 24.1 bits, see alignment E=6.5e-09 PF09115: DNApol3-delta_C" amino acids 210 to 321 (112 residues), 30.8 bits, see alignment E=5.3e-11

Best Hits

Swiss-Prot: 73% identical to HOLB_PSEAE: DNA polymerase III subunit delta' (holB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02341, DNA polymerase III subunit delta' [EC: 2.7.7.7] (inferred from 99% identity to ppf:Pput_3794)

Predicted SEED Role

"DNA polymerase III delta prime subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LG7 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PP_1966 DNA polymerase III subunit delta' (Pseudomonas putida KT2440)
MAEAYPWQQALWQQLAGRSRHAHAYLLHGPQGIGKRAMAERLMARLLCQQPQGLDACGAC
KSCLLLKAGSHPDNFVLEPEEADKPIKVDQVRELVAFVVQTAQLGGRKVVLIEPVEAMNV
NASNALLKSLEEPSGDTVLLLVTHQPSRLLPTIKSRCQQVACPQPSLAQSQAWLAGALPD
CDEVERDELLTLAAGSPLMAVSLQAQGVREQRALVTDGVKKLLKQQQSPSQLADAWSGVP
LLLLFDWFCDWTHLILRYQLTQDEEGLGLADMRKVVQYLAQKSRQAKVLEVQAWILEQRQ
KVLGKANLNRALLLESLLAHWLQLPGAR