Protein Info for PP_1957 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, Pdr/VanB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 238 to 307 (70 residues), 46.1 bits, E=1.9e-16

Best Hits

Swiss-Prot: 47% identical to VANB_PSEUH: Vanillate O-demethylase oxidoreductase (vanB) from Pseudomonas sp. (strain HR199 / DSM 7063)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1957)

MetaCyc: 47% identical to vanillate O-demethylase reductase component (Pseudomonas sp. HR199)
Vanillate monooxygenase. [EC: 1.14.13.82]

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

• vanillin and vanillate degradation II (2/2 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-, 1.14.13.82

Use Curated BLAST to search for 1.14.13.- or 1.14.13.82

Sequence Analysis Tools

See Q88LH5 at UniProt or InterPro

Protein Sequence (317 amino acids)

>PP_1957 Oxidoreductase, Pdr/VanB family (Pseudomonas putida KT2440)
MQNWLELEISRREKATEAISVFELRHPNGEKLPAFTAGAHIDVKVRDGLVRQYSLSNDPV
ETDRYVIAVLNEPTSRGGSRAIHEQFLQGMKISVGEPRNHFPLLDADDHFVLVAGGIGVT
PILAMARYLNRIGRSFEIHYCIRSRSTGAFLDVFQGPEFAGRVTLHVDDDPESTPLELAR
VLDKERARLYVCGPGGFMNWVLSTAEGCLSPERVHKESFSAEPIAAATDDGFEVEVASTG
QVFFIPTERSITEVLEEAGVEVLVSCQQGICGSCITNVLEGEPDHRDSVLSESERKSGKV
FTPCCSRSKSPRLVLDL