Protein Info for PP_1957 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, Pdr/VanB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 110 to 129 (20 residues), see Phobius details PF00111: Fer2" amino acids 238 to 307 (70 residues), 46.1 bits, see alignment E=1.9e-16

Best Hits

Swiss-Prot: 47% identical to VANB_PSEUH: Vanillate O-demethylase oxidoreductase (vanB) from Pseudomonas sp. (strain HR199 / DSM 7063)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1957)

MetaCyc: 47% identical to vanillate O-demethylase reductase component (Pseudomonas sp. HR199)
Vanillate monooxygenase. [EC: 1.14.13.82]

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-, 1.14.13.82

Use Curated BLAST to search for 1.14.13.- or 1.14.13.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LH5 at UniProt or InterPro

Protein Sequence (317 amino acids)

>PP_1957 Oxidoreductase, Pdr/VanB family (Pseudomonas putida KT2440)
MQNWLELEISRREKATEAISVFELRHPNGEKLPAFTAGAHIDVKVRDGLVRQYSLSNDPV
ETDRYVIAVLNEPTSRGGSRAIHEQFLQGMKISVGEPRNHFPLLDADDHFVLVAGGIGVT
PILAMARYLNRIGRSFEIHYCIRSRSTGAFLDVFQGPEFAGRVTLHVDDDPESTPLELAR
VLDKERARLYVCGPGGFMNWVLSTAEGCLSPERVHKESFSAEPIAAATDDGFEVEVASTG
QVFFIPTERSITEVLEEAGVEVLVSCQQGICGSCITNVLEGEPDHRDSVLSESERKSGKV
FTPCCSRSKSPRLVLDL