Protein Info for PP_1953 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, short chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 159 to 177 (19 residues), see Phobius details PF00106: adh_short" amino acids 6 to 218 (213 residues), 176.9 bits, see alignment E=7.1e-56 PF01370: Epimerase" amino acids 8 to 105 (98 residues), 23.4 bits, see alignment E=7.4e-09 PF08659: KR" amino acids 8 to 92 (85 residues), 36 bits, see alignment E=1.3e-12 PF13561: adh_short_C2" amino acids 12 to 104 (93 residues), 62.5 bits, see alignment E=9.2e-21 amino acids 121 to 268 (148 residues), 149.9 bits, see alignment E=1.8e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1953)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LH9 at UniProt or InterPro

Protein Sequence (269 amino acids)

>PP_1953 Oxidoreductase, short chain dehydrogenase/reductase family (Pseudomonas putida KT2440)
MSFQNKIVVLTGAASGIGKATAQLLVEQGAHVVAMDLKSDLLQQAFGSEEHVLCIPTDVS
DSEAVRAAFQAVDAKFGRVDVIINAAGINAPTREANQKMVDANVAALDAMKSGRAPTFDF
LADTSDQDFRRVMEVNLFSQFYCIREGVPLMRRAGGGSIVNISSVAALLGVAMPLYYPAS
KAAVLGLTRAAAAELAPYNIRVNAIAPGSVDTPLMHEQPPEVVQFLVSMQPIKRLAQPEE
LAQSILFLAGEHSSFITGQTLSPNGGMHM