Protein Info for PP_1951 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, short chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF08659: KR" amino acids 13 to 98 (86 residues), 31.3 bits, see alignment E=2.8e-11 PF00106: adh_short" amino acids 14 to 214 (201 residues), 157 bits, see alignment E=6.5e-50 PF13561: adh_short_C2" amino acids 18 to 269 (252 residues), 194.7 bits, see alignment E=2.9e-61

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1951)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LI1 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PP_1951 Oxidoreductase, short chain dehydrogenase/reductase family (Pseudomonas putida KT2440)
MKLDTVFSVEGARVIVTGAASGLGLAFTEAMAESGAQVAMLDLNREALDAQFRRLRSLGY
SVRSHVLDVTDRDAVDDTFNAVAAGFGGLDIVFANAGIDPGPGFAALNAAGEREPANMLE
EYSDHRWRKVISVSLDAVFYSIRAAARHMRANRSGSIIVTTSVSALRPAVTLGAAYAAAK
AGAAQLVRATALELASDGVRVNAIAPGPFETDIGGGFMHNSEVRAKMAAGVPMGRIAEVE
EIKPLALYLASKASSFVTGQQFVIDGGLSLSAARA