Protein Info for PP_1946 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, short chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00106: adh_short" amino acids 10 to 200 (191 residues), 191 bits, see alignment E=2.5e-60 PF08659: KR" amino acids 12 to 163 (152 residues), 25.4 bits, see alignment E=1.9e-09 PF13561: adh_short_C2" amino acids 16 to 249 (234 residues), 215.6 bits, see alignment E=1.2e-67

Best Hits

Swiss-Prot: 38% identical to FABG_THEMA: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1946)

MetaCyc: 36% identical to aminoalcohol dehydrogenase (Rhodococcus sp. TMP1)
1.1.1.-

Predicted SEED Role

"oxidoreductase, short chain dehydrogenase/reductase family"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LI6 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PP_1946 Oxidoreductase, short chain dehydrogenase/reductase family (Pseudomonas putida KT2440)
MTVNYDFSGKVVLVTGAGSGIGRATALAFAQSGASVAVADISTDHGLKTVELVKAEGGEA
TFFHVDVGSEPSVQSMLAGVVAHYGGLDIAHNNAGIEANIVPLAELDSDNWRRVIDVNLS
SVFYCLKGEIPLMLKRGGGAIVNTASASGLIGGYRLSGYTATKHGVVGLTKAAAIDYANQ
NIRINAVCPGPVDSPFLADMPQPMRDRLLFGTPIGRLATAEEIARSVLWLCSDDAKYVVG
HSMSVDGGVAVTAVGTRMDDLF