Protein Info for PP_1925 in Pseudomonas putida KT2440

Annotation: putative Monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF07992: Pyr_redox_2" amino acids 9 to 202 (194 residues), 40.7 bits, see alignment E=8.3e-14 PF13738: Pyr_redox_3" amino acids 11 to 199 (189 residues), 87.1 bits, see alignment E=5.5e-28 PF13450: NAD_binding_8" amino acids 12 to 47 (36 residues), 24.5 bits, see alignment 1.1e-08 PF13434: Lys_Orn_oxgnase" amino acids 107 to 195 (89 residues), 33.2 bits, see alignment E=1.3e-11 PF00743: FMO-like" amino acids 126 to 199 (74 residues), 59.7 bits, see alignment E=7.8e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1925)

MetaCyc: 56% identical to [arsenate oxidoreductase]-[AioE protein] oxidoreductase (Agrobacterium tumefaciens GW4)
1.20.98.-

Predicted SEED Role

"monooxygenase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LK6 at UniProt or InterPro

Protein Sequence (360 amino acids)

>PP_1925 putative Monooxygenase (Pseudomonas putida KT2440)
MAAEGELLDVIVIGGGQSALTVAYFLKRAKLSFLLLDAEEAAGGAWRHGWDSLTLFSPSA
WSTIAGWPMPPFTEGNPDGDHVVSYLEQYEARYGFSIVRPVSVTSVERTGRGLRVRSKDR
DWEARVVISATGTWSNPYVPAYSGIELFQGQQIHSAHYQSPEAFQGKRVLVVGGGNSGAQ
IYAELSEVADATWVTTEEPAFLPDDVDGRVLFERATERLKAQQEGRVIDAPVGGLGDIVM
VPSVVRARERGALRAVRPFTSFTPDGVAWLNGEKTQVDAVVWCTGFLPALDHLKTLDVLD
DNGRVEVDGGHSIREPRLWLVGYGDWTGLASATLIGVTRTARSTVNEVVEHLNSLEQPDA