Protein Info for PP_1913 in Pseudomonas putida KT2440

Annotation: malonyl-CoA-ACP transacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00128: malonyl CoA-acyl carrier protein transacylase
  • amino acids 5 to 290 (286 residues), 387 bits, E=3.1e-120
• PF00698: Acyl_transf_1
  • amino acids 7 to 278 (272 residues), 145.1 bits, E=1.8e-46

Best Hits

Swiss-Prot: 62% identical to FABD_SALTY: Malonyl CoA-acyl carrier protein transacylase (fabD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00645, [acyl-carrier-protein] S-malonyltransferase [EC: 2.3.1.39] (inferred from 99% identity to ppf:Pput_3801)

MetaCyc: 62% identical to [acyl-carrier-protein] S-malonyltransferase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-malonyltransferase. [EC: 2.3.1.39]

Predicted SEED Role

"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
• fatty acid biosynthesis initiation (plant mitochondria) (1/4 steps found)
• mycobactin biosynthesis (2/11 steps found)
• pederin biosynthesis (2/14 steps found)
• bryostatin biosynthesis (2/19 steps found)
• mupirocin biosynthesis (2/26 steps found)
• corallopyronin A biosynthesis (2/30 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

See Q88LL7 at UniProt or InterPro

Protein Sequence (312 amino acids)

>PP_1913 malonyl-CoA-ACP transacylase (Pseudomonas putida KT2440)
MSASLAFVFPGQGSQSLGMLAELGAEKPVIIETFKEASEALGYDLWKLVQDGPEEQLNQT
DKTQPAILTASIALWRLWLEEGGAKPAFVSGHSLGEYSALVAAGSISLKDAVRLVERRGQ
LMQEAVPAGHGAMAAILGLDDAVVVELCAEAAEDEVVSAVNFNSPGQVVIAGNKAAVDRA
MELCKAKGAKRALPLAVSVPSHCALMKPAAERFAESVNAIEWKAPQIPVVQNVTAAVAAD
LDALKHDLLAQLYQPVRWVECVQTLAANGAVNLVECGPGKVLAGLNKRCADGVTTYNLNT
PDAVAATRAALA