Protein Info for PP_1912 in Pseudomonas putida KT2440

Annotation: Phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 TIGR00182: fatty acid/phospholipid synthesis protein PlsX" amino acids 6 to 334 (329 residues), 342.2 bits, see alignment E=1.6e-106 PF02504: FA_synthesis" amino acids 6 to 325 (320 residues), 329.6 bits, see alignment E=2e-102 PF01515: PTA_PTB" amino acids 86 to 215 (130 residues), 30 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 100% identical to PLSX_PSEPK: Phosphate acyltransferase (plsX) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 100% identity to ppu:PP_1912)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LL8 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PP_1912 Phosphate acyltransferase (Pseudomonas putida KT2440)
MSAQVIAIDAMGGDFGPRSIVQASIACLSATPSLHLTLVGQPSLLEDLISGLPAADRARL
QVVAASEVVGMDERPSQALRGKPDSSMRIALELVRDGKAQACVSAGNTGALMALSRFVLK
TLPGIDRPAMVAAIPTQTGYCQLLDLGANVDCSAENLYQFAVMGSVAAQALGVHRPRVAL
LNIGTEDIKGNQQVKLAATLLQSARGLNYVGFVEGDGLYRGEADVVVCDGFVGNILLKSS
EGLATMIGARIEKLFKGGAFARVAGAVAMPLLKRLQADLAPARHNGASFLGLQGIVIKSH
GSAGVQGFQSAIQRALIEIQENLPQRLHGRLEDLLP