Protein Info for PP_1906 in Pseudomonas putida KT2440

Annotation: ribosomal large subunit pseudouridine synthase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR00005: pseudouridine synthase, RluA family" amino acids 20 to 312 (293 residues), 261.7 bits, see alignment E=4.4e-82 PF01479: S4" amino acids 23 to 69 (47 residues), 33.5 bits, see alignment 2.8e-12 PF00849: PseudoU_synth_2" amino acids 104 to 252 (149 residues), 108.5 bits, see alignment E=3.8e-35

Best Hits

Swiss-Prot: 82% identical to RLUC_PSEAE: Ribosomal large subunit pseudouridine synthase C (rluC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06179, ribosomal large subunit pseudouridine synthase C [EC: 5.4.99.12] (inferred from 98% identity to pen:PSEEN1609)

MetaCyc: 58% identical to 23S rRNA pseudouridine955/2504/2580 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11838 [EC: 5.4.99.24]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FW35 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PP_1906 ribosomal large subunit pseudouridine synthase C (Pseudomonas putida KT2440)
MTTNTPPTSGVQLIEVAPELAGQRIDNFLITALKGVPKTLVYRILRKGEVRVNKGRVKPE
YKIQAGDIVRVPPVRLPERDEPAPVAQGLLQRLEAAIVYEDKALIVMNKPAGIAVHGGSG
LSFGVIEALRQLRPDAKELELVHRLDRDTSGLLMIAKKRSMLRHLHAALRGDGVDKRYMA
LVRGHWPTSKKQVNAPLLKSNLRSGERMVEVNEEGKEALTLFRVLRRFGDFATIVEARPI
TGRTHQIRVHTLHAGHMIAGDSKYGDEDFSREIRELGGKRLFLHAYALTVPLPDGGELKL
EAPVDEVWAKTVERLSAP