Protein Info for PP_1873 in Pseudomonas putida KT2440

Annotation: Peptide methionine sulfoxide reductase MsrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR00357: methionine-R-sulfoxide reductase" amino acids 6 to 127 (122 residues), 186.4 bits, see alignment E=1.1e-59 PF01641: SelR" amino acids 15 to 128 (114 residues), 173.9 bits, see alignment E=5.4e-56

Best Hits

Swiss-Prot: 100% identical to MSRB_PSEPK: Peptide methionine sulfoxide reductase MsrB (msrB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 98% identity to ppg:PputGB1_1448)

MetaCyc: 54% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LQ6 at UniProt or InterPro

Protein Sequence (131 amino acids)

>PP_1873 Peptide methionine sulfoxide reductase MsrB (Pseudomonas putida KT2440)
MKKIEKTLDEWRSMLDPEQYQVCRLKGTERPFSGKYNSERRDGIYHCICCGLPLFDAQTK
FDAGCGWPSFYAPIEDSAMIEIRDTSHGMIRTEVTCARCDAHLGHVFPDGPPPTGLRYCI
NSVCIDLRPRD