Protein Info for PP_1871 in Pseudomonas putida KT2440

Annotation: Protease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details PF01435: Peptidase_M48" amino acids 82 to 294 (213 residues), 127.5 bits, see alignment E=2.8e-41

Best Hits

Swiss-Prot: 100% identical to HTPX_PSEPK: Protease HtpX (htpX) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 98% identity to ppw:PputW619_1480)

Predicted SEED Role

"Probable protease htpX homolog (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LQ8 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PP_1871 Protease HtpX (Pseudomonas putida KT2440)
MMRILLFVATNLAVVLVASITLSLFGFNGFMAANGVDLNLSSLLVFCAVFGFAGSLVSLF
ISKWMAKMTTGTQIISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN
RNDALVAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALVQGVVNTFVMFFARIIGN
FVDKVIFKNEEGQGIAYYVATIVAELILGILASMIVMWFSRRREFRADEAGAQLAGTAAM
IGALQRLRVEQGLPVHMPDTMKAFGINGGLKHGLAGLLMSHPPLEDRIEALRQRG