Protein Info for PP_1860 in Pseudomonas putida KT2440

Annotation: Organic hydroperoxide resistance transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12802: MarR_2
  • amino acids 40 to 98 (59 residues), 43.6 bits, E=3.9e-15
• PF13463: HTH_27
  • amino acids 42 to 108 (67 residues), 24.7 bits, E=3.5e-09
• PF01047: MarR
  • amino acids 42 to 100 (59 residues), 55.3 bits, E=7.5e-19

Best Hits

Swiss-Prot: 49% identical to OHRR_BACSU: Organic hydroperoxide resistance transcriptional regulator (ohrR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_3854)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Sequence Analysis Tools

See Q88LR8 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PP_1860 Organic hydroperoxide resistance transcriptional regulator (Pseudomonas putida KT2440)
MNADTQASCDELLLDNQVCFALHSTSLLMTKVYKPLLQALGLTYPQYLAMLVLWERDGLT
VGEISQHLLTDPGSLTPLLKRLESEGLLQRNRSREDERVVMVQLTDKGRALQQQAKEVPP
CILKASGRSLEQLQQLQADLLNLRENLQKNL