Protein Info for PP_1844 in Pseudomonas putida KT2440

Annotation: 1-acyl-sn-glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 101 to 117 (17 residues), see Phobius details PF01553: Acyltransferase" amino acids 67 to 180 (114 residues), 122.7 bits, see alignment E=4.6e-40 TIGR00530: 1-acylglycerol-3-phosphate O-acyltransferases" amino acids 67 to 180 (114 residues), 142.2 bits, see alignment E=4e-46

Best Hits

KEGG orthology group: K00655, 1-acyl-sn-glycerol-3-phosphate acyltransferase [EC: 2.3.1.51] (inferred from 100% identity to ppu:PP_1844)

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LT3 at UniProt or InterPro

Protein Sequence (237 amino acids)

>PP_1844 1-acyl-sn-glycerol-3-phosphate acyltransferase (Pseudomonas putida KT2440)
MLYSLRMFLLGLHFLAVGAVGLLIGLCRPFNPDNSRVFARLYSLPATWLMRIEVKAEVGP
LWDHPPGCVIVANHQSNFDLFVLGQVVPQRTVAIGKKSLGWIPLFGQLFWLGGNVLVDRK
NAYQARRALQKTTRVLQDDTSIWIFPEGTRNPGEHLLAFKKGAFHMAIEAGVPIVPVCVS
RYARRLSLNSWRQRTVIVRSLPPIATTGMTLQDLPALIEQCRGQMQQCIDRMEKELA