Protein Info for PP_1836 in Pseudomonas putida KT2440

Annotation: putative metal transporter, ZIP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details PF02535: Zip" amino acids 161 to 307 (147 residues), 99.1 bits, see alignment E=1.5e-32

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 99% identity to ppf:Pput_3874)

Predicted SEED Role

"Metal transporter, ZIP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LU1 at UniProt or InterPro

Protein Sequence (312 amino acids)

>PP_1836 putative metal transporter, ZIP family (Pseudomonas putida KT2440)
MPPTHSQSAAPPSLLQAWRQQAIDTPWLSAGLGLSLLAVCVLLAASLWNAVNGDHADNLH
LAMLGGLSGFGATALGAVLAVVLRDVNARTQDVMLGFAAGMMLAASSFSLILPGLEAARE
ITGNGPAAAFTVVLGMGLGVLLMLGLDRFTPHEHESTGPCGPEAERISRVWLFVLAITLH
NLPEGMAIGVSFANGDMNIGLPLTSAIAIQDIPEGLAVALALRATGLSNLKAALVAIGSG
LMEPLGAVIGLGISTGFALAYPISMGLAAGAMIFVVSHEVIPETHRNGHQTAATLGLMGG
FAVMMFLDTALG