Protein Info for PP_1831 in Pseudomonas putida KT2440

Annotation: putative Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 317 (25 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details PF12832: MFS_1_like" amino acids 6 to 359 (354 residues), 355.2 bits, see alignment E=6.9e-110 PF03825: Nuc_H_symport" amino acids 8 to 355 (348 residues), 57.1 bits, see alignment E=2.5e-19 PF07690: MFS_1" amino acids 12 to 245 (234 residues), 39.1 bits, see alignment E=6.8e-14 amino acids 208 to 376 (169 residues), 49.1 bits, see alignment E=6.2e-17

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 100% identity to ppu:PP_1831)

Predicted SEED Role

"Nucleoside:H+ symporter:Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LU6 at UniProt or InterPro

Protein Sequence (384 amino acids)

>PP_1831 putative Membrane protein (Pseudomonas putida KT2440)
MQPIPYWRLSSFYLFYFALLGSTAPFLALYFDHLGFSPARIGELVAIPMLMRCVAPNLWG
WLGDRTGQRLLIVRLGALCTLATFALIFFGKSYAWLALVMALHAFFWHAVLPQFEVITLA
HLHGQTSRYSQVRLWGSIGFILTVVGLGRLFEWLSLDIYPVALVTIMAGIVAASLWVPNA
QPVEQGGRSGTGGFLQQLRAPGVIAFYVCVALMQLSHGPYYTFLTLHLEHLGYTRGAIGL
LWALGVVAEVLMFMVMSRLFARFSVQRVLLVSFLLAALRWLLLGNLAQESAVLIFAQLLH
AATFGCFHAASIAFVQASFGARQQGQGQALYAALSGTGGALGALYSGYSWKLLGPTFTFG
MASAAALVAAVIIALCSQPTRTRP