Protein Info for PP_1817 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 8 to 199 (192 residues), 197.6 bits, E=2.3e-62
• PF08659: KR
  • amino acids 10 to 163 (154 residues), 36.4 bits, E=7.6e-13
• PF13561: adh_short_C2
  • amino acids 14 to 251 (238 residues), 235.2 bits, E=1.2e-73

Best Hits

Swiss-Prot: 46% identical to LINC_SPHIB: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase (linB) from Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_3894)

MetaCyc: 43% identical to cyclohexanol dehydrogenase (Aromatoleum aromaticum EbN1)
1.1.1.-

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

• bisphenol A degradation (2/5 steps found)
• 4-ethylphenol degradation (anaerobic) (2/6 steps found)

Sequence Analysis Tools

See Q88LW0 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PP_1817 Oxidoreductase, short-chain dehydrogenase/reductase family (Pseudomonas putida KT2440)
MSMTFSGQVALVTGAGAGIGRATALAFAHEGMKVVVADLDPVGGEATVAQIHAAGGEALF
IACDVTRDAEVRQLHERLMAAYGRLDYAFNNAGIEIEQHRLAEGSEAEFDAIMGVNVKGV
WLCMKYQLPLLLAQGGGAIVNTASVAGLGAAPKMSIYSASKHAVIGLTKSAAIEYAKKGI
RVNAVCPAVIDTDMFRRAYQADPRKAEFAAAMHPVGRIGKVEEIASAVLYLCSDGAAFTT
GHCLTVDGGATAI