Protein Info for PP_1802 in Pseudomonas putida KT2440

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF13439: Glyco_transf_4" amino acids 16 to 174 (159 residues), 68.1 bits, see alignment E=2.5e-22 PF13579: Glyco_trans_4_4" amino acids 17 to 171 (155 residues), 56 bits, see alignment E=1.6e-18 PF00534: Glycos_transf_1" amino acids 191 to 345 (155 residues), 114 bits, see alignment E=1.4e-36 PF13692: Glyco_trans_1_4" amino acids 196 to 333 (138 residues), 89.9 bits, see alignment E=4.9e-29 PF13524: Glyco_trans_1_2" amino acids 273 to 358 (86 residues), 26.3 bits, see alignment E=1.7e-09

Best Hits

KEGG orthology group: K12995, rhamnosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to ppu:PP_1802)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LX5 at UniProt or InterPro

Protein Sequence (369 amino acids)

>PP_1802 glycosyl transferase (Pseudomonas putida KT2440)
MIKVLHFFKTYYPDSMGGIEQVIFQIAEGTREHGVQSEVLYLSPRGAARNEPVGSHLTHR
SKLDLHVASTGFSLSVIKDFAELAAQADIVHYHFPWPYMDLVHFLGRLNKPTVVSYHSDI
IKQKWLLKLYQPLMSRFLSNVDRIVVSSPNYAAHSQVLTRFKDKLAIIPFGLDRATYPSA
TVEKLAYWRARMSERFFLFVGALRYYKGLDYLLQAASINRLPVVIIGGGFLEAQLKQQAA
ELRLDNVQFLGSLADDDRAALLELCYAFVFPSHLRSESFGISLLEAAMYGKPLICCEMGS
GTTFINLADQTGLVVPPRDAAALAQAMQRLWDDPAMAQAMGAKALQRYEEVFTASAMAGA
YADLYRSLL