Protein Info for PP_1799 in Pseudomonas putida KT2440

Annotation: GDP-mannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF04321: RmlD_sub_bind" amino acids 13 to 191 (179 residues), 30.8 bits, see alignment E=2.5e-11 TIGR01472: GDP-mannose 4,6-dehydratase" amino acids 14 to 347 (334 residues), 482.2 bits, see alignment E=4.6e-149 PF16363: GDP_Man_Dehyd" amino acids 16 to 341 (326 residues), 470.8 bits, see alignment E=4.4e-145 PF01370: Epimerase" amino acids 16 to 256 (241 residues), 237.2 bits, see alignment E=2.6e-74

Best Hits

Swiss-Prot: 73% identical to GM4D_AGGAC: GDP-mannose 4,6-dehydratase (gmd) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 100% identity to ppu:PP_1799)

MetaCyc: 73% identical to GDP-alpha-D-mannose 4,6-dehydratase (Aggregatibacter actinomycetemcomitans)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LX8 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PP_1799 GDP-mannose 4,6-dehydratase (Pseudomonas putida KT2440)
MPARHYRSWLSRMKAIVTGITGQDGAYLAELLLEKGYTVYGTYRRTSSVNFWRIEELGIH
TNPNLHLVEYDLTDLSASIRLLQTTEATEVYNLAAQSFVGVSFEQPLTTAEITGLGAVNL
LEAIRIVNPKARFYQASTSEMFGKVQEIPQVETTPFYPRSPYGVAKLYAHWMTINYRESY
NLFATSGILFNHESPLRGREFVTRKITDSVAKIKLGLLDKLELGNLDAKRDWGFAKEYVE
GMWRMLQADEPDTFVLATNRTETVRDFVTMAFKAAGIEINWSGKDEAEQGTCAASGKVLV
AINPKFYRPAEVELLIGNPAKAKDVLGWEPKTNLEELCRMMVEADLRRNEKGFSF