Protein Info for PP_1798 in Pseudomonas putida KT2440

Annotation: Outer membrane efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 42 to 452 (411 residues), 245.8 bits, see alignment E=4.2e-77 PF02321: OEP" amino acids 47 to 229 (183 residues), 43.8 bits, see alignment E=1.2e-15 amino acids 254 to 434 (181 residues), 100.1 bits, see alignment E=6.5e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1798)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LX9 at UniProt or InterPro

Protein Sequence (471 amino acids)

>PP_1798 Outer membrane efflux protein (Pseudomonas putida KT2440)
MIVLRLLPGVMMCMVAWQAVAMEGKDAAGEQPRGVSASTYVLDLAGLYREARLEDPRVLA
AYARARSASEQQRAALGSLLPQVSANANSSRILRKNEAERDLYNTETYSLSLTQYLYNKP
AWERYQKSKSVKDQKGHEAEDTLAEATVDLAKRYFVALAADDELALVQAERRATQKNLDR
VSSMFERQMAKITDKLDMQARVDFLLAQEVEARNQVQVSREALAEIVGRPITEPLSRVRN
DVALQAPTRPLQNWVTQAVENNPLLKSYQSGAEAANAAVREGKGEHYPQLSLSLSAQQND
QGYDNTQAPRSDSYVASFGVKIPIYSGGSTSARVRGLYDDQLAAEEQLEGVRRQVVKETT
TAYLTAQAAVEKIRANRNALSSAQHSSVAAQKAFTFGVVNAVDVLTAVQNEFKARRDLLK
TQYDFITNLFLLNRWAGELNQESVDNVNVWLSPVPETSLPGGEVARLGASR