Protein Info for PP_1797 in Pseudomonas putida KT2440

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 24 to 440 (417 residues), 381.6 bits, see alignment E=2.5e-118 PF25973: BSH_CzcB" amino acids 71 to 321 (251 residues), 34.6 bits, see alignment E=2.2e-12 PF25994: HH_AprE" amino acids 100 to 287 (188 residues), 140 bits, see alignment E=1.6e-44 PF26002: Beta-barrel_AprE" amino acids 329 to 417 (89 residues), 111.3 bits, see alignment E=3e-36

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to ppu:PP_1797)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LY0 at UniProt or InterPro

Protein Sequence (441 amino acids)

>PP_1797 HlyD family secretion protein (Pseudomonas putida KT2440)
MSSKAITTFDHNFDDLPTSDRGIRRIGLTVVFVTFGIFGTWAAFAPLSNAVHGTGVVTVQ
NYRKTVQHLEGGIVKELHARDGDLVKKGDPLIVLDESQLSAEYESTRNQLIVARYKEARL
RAERDGLDSIPSVIMEGTDSDRAQEALAGEQQVFKARHDSLLGEISVNRERIQQMQQQIA
GLNDMIRTKAGLNKSYSGEIKQLKELLAEGFVDNQRLLEQERKLDMLKTEVADHQSSITK
TKLQIGETELQIVQLKKKFDADVAKELSDVQAQVFDLQEKEAALRDRLSRVVIRAPESGM
VLDMKVHTIGGVVSAATPLLDIVPAQSDLVVEAKVAPRDIDRLELGKTADVRFSAFNQAT
TPVIEGKLTRISADSLVEERSGDQYYLVRVKVTEDGMKKLGNRKLQPGMPAEVLINAGDR
TMLQYLLKPARNMFAESLIEE