Protein Info for PP_1785 in Pseudomonas putida KT2440

Annotation: dTDP-glucose 4,6-dehydratase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF01370: Epimerase" amino acids 2 to 250 (249 residues), 237.3 bits, see alignment E=5.1e-74 PF04321: RmlD_sub_bind" amino acids 2 to 174 (173 residues), 46.9 bits, see alignment E=6e-16 PF02719: Polysacc_synt_2" amino acids 2 to 112 (111 residues), 42.3 bits, see alignment E=1.7e-14 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 2 to 347 (346 residues), 498.6 bits, see alignment E=3.4e-154 PF01073: 3Beta_HSD" amino acids 3 to 229 (227 residues), 35.5 bits, see alignment E=1.7e-12 PF16363: GDP_Man_Dehyd" amino acids 3 to 334 (332 residues), 321.4 bits, see alignment E=2.6e-99 PF07993: NAD_binding_4" amino acids 75 to 186 (112 residues), 27 bits, see alignment E=7.5e-10

Best Hits

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 100% identity to ppu:PP_1785)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LZ1 at UniProt or InterPro

Protein Sequence (366 amino acids)

>PP_1785 dTDP-glucose 4,6-dehydratase 2 (Pseudomonas putida KT2440)
MILVTGGAGFIGSNFVLQWCAHNEEPVLNLDALTYAGNLANLQPLEGNPQHRFVQGNICD
AALLTKLFAEHRPRAVVHFAAESHVDRSITGPEAFVETNVMGTFRLLEAARAHWNSLEGA
EKEAFRFLHVSTDEVYGTLGPNDPAFTETTPYAPNSPYSASKAASDHLVRSYFHTYGMPV
LTTNCSNNYGPLHFPEKLIPLMIVNALAGKALPVYGDGQQIRDWLYVEDHCSGIRRVLEA
GAFGETYNIGGWNEKANIDIVRTLCSLLDEMAPAASRQVINQKTGEPVEQYAELIAYVTD
RPGHDRRYAIDARKIERELGWKPAETFETGIRKTVAWYLANQKWVKGVMDGSYRDWVAQQ
YGANKA