Protein Info for PP_1783 in Pseudomonas putida KT2440

Annotation: dTDP-glucose pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 36 to 54 (19 residues), see Phobius details TIGR01207: glucose-1-phosphate thymidylyltransferase" amino acids 4 to 289 (286 residues), 516.2 bits, see alignment E=1e-159 PF00483: NTP_transferase" amino acids 4 to 240 (237 residues), 267.8 bits, see alignment E=9.4e-84 PF12804: NTP_transf_3" amino acids 5 to 137 (133 residues), 39.1 bits, see alignment E=9e-14

Best Hits

Swiss-Prot: 75% identical to RMLA_SALAN: Glucose-1-phosphate thymidylyltransferase (rmlA) from Salmonella anatum

KEGG orthology group: K00973, glucose-1-phosphate thymidylyltransferase [EC: 2.7.7.24] (inferred from 100% identity to ppu:PP_1783)

MetaCyc: 74% identical to glucose-1-phosphate thymidylyltransferase 1 (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate thymidylyltransferase. [EC: 2.7.7.24]

Predicted SEED Role

"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.24

Use Curated BLAST to search for 2.7.7.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LZ3 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PP_1783 dTDP-glucose pyrophosphorylase (Pseudomonas putida KT2440)
MARKGIILAGGSGTRLHPATLSVSKQLLPVYDKPMIYYPLSTLLLAGIRDILIISTPQDT
PRFEQLLGDGSQWGLNLSYAIQPSPDGLAQAFTIGADFIGNDPSALVLGDNIFYGHDFQA
LLLNADKRESGASVFAYHVHDPERYGVAEFDDSGRVLSLEEKPAVPKSSYAVTGLYFYDN
QVVNLARELKPSPRGELEITDLNNLYLQQQQLQVEIMGRGYAWLDTGTHDSLLEASQYIA
TMERRQGLKVACPEEICYRAGWINAEQLECLAQPLLKNGYGKYLQNLLKEKVF