Protein Info for PP_1778 in Pseudomonas putida KT2440

Annotation: Lipopolysaccharide ABC export system, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 109 to 136 (28 residues), see Phobius details amino acids 145 to 172 (28 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 18 to 223 (206 residues), 90.8 bits, see alignment E=4.6e-30

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 100% identity to ppu:PP_1778)

MetaCyc: 40% identical to O:9 antigen ABC transporter permease component (Escherichia coli O9a)
RXN-22100 [EC: 7.5.2.14]

Predicted SEED Role

"O-antigen export system permease protein RfbD"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LZ8 at UniProt or InterPro

Protein Sequence (264 amino acids)

>PP_1778 Lipopolysaccharide ABC export system, permease protein (Pseudomonas putida KT2440)
MFGMIKGIWSYRGFIISSIKNEFISRFARSKLGGLWMIIHPLAQVAIYALILSNVLAAKL
PGIDNKYAYALYLMAGILAWNLFAEIVSRCLTLFIEQGNIMKKMRFPRITLPVIVVGSCL
LNNVLLFAAVMLVFSLLGHYPTLQILWLIPLVMIVVALSVGIGLVLGILNVFLRDVGQVV
PIVLQVLFWFTPIVYMVNVIPEHLRATLSFNPMYPIVTAYHDVLLYAKAPDLSQAVVMTG
ISFGLLLLGLFLFRRSVPEMVDVL