Protein Info for PP_1776 in Pseudomonas putida KT2440

Annotation: Mannose-6-phosphate isomerase/mannose-1-phosphate guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 3 to 477 (475 residues), 576 bits, see alignment E=3.1e-177 PF00483: NTP_transferase" amino acids 5 to 290 (286 residues), 174.3 bits, see alignment E=5.1e-55 PF01050: MannoseP_isomer" amino acids 323 to 473 (151 residues), 226.1 bits, see alignment E=2.8e-71 PF07883: Cupin_2" amino acids 390 to 456 (67 residues), 33.4 bits, see alignment E=4.5e-12

Best Hits

Swiss-Prot: 47% identical to ALGA_PSESM: Alginate biosynthesis protein AlgA (algA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] (inferred from 100% identity to ppu:PP_1776)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.22

Use Curated BLAST to search for 2.7.7.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M00 at UniProt or InterPro

Protein Sequence (480 amino acids)

>PP_1776 Mannose-6-phosphate isomerase/mannose-1-phosphate guanylyltransferase (Pseudomonas putida KT2440)
MELIPVILSGGVGSRLWPVSREAHPKPFMTLPDGQNLIQKTFLRAADLNGVVEILTVTNR
ELLFKTEDEYRTINKQNLSQGYILEPFGRNTAAAVAAAALQLLESHGPQVHMLVLAADHL
IQNEAAFSEAVSKAVQLAGEGWLVTFGIKPQYPETGFGYIEAAAGGVLEGGLRVERFVEK
PDAKTAEAYVAAGNYFWNAGMFCFQVGTVIEQFRAYAPDVLEAVERTLEASRRSTSKGYS
CLALDAECFASVPDISIDYALMERSSKVATIPCDIGWSDIGSWNAVSELTLPDEHGNRFD
GEVMAYGASNNYVSTEDRLAALVGVQDLLVVDTPDALLIAHKDHAQDVKHIVKRLKNDGH
TAHLLHQTVHRPWGTYTTLEDGERFKIKRIVVKPKASLSLQMHHHRSEHWIVVSGMAVVV
NDDQELMLNTNESTFIRAGHKHRLQNPGVIDLVLIEVQSGDYLGEDDIVRFEDNYGRCDA