Protein Info for PP_1774 in Pseudomonas putida KT2440

Annotation: conserved exported protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 signal peptide" amino acids 21 to 23 (3 residues), see Phobius details transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details PF06305: LapA_dom" amino acids 43 to 99 (57 residues), 36.7 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1774)

Predicted SEED Role

"FIG00955403: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M02 at UniProt or InterPro

Protein Sequence (104 amino acids)

>PP_1774 conserved exported protein of unknown function (Pseudomonas putida KT2440)
MKTSMKRPTPDSTRSNLMRNLKRALAAVFVLLLAAVVLFFVLENQQTVSLVLFGWAAPAM
PVAVLVLAALVIGLAVGPLLGAYGVQRSKRKIRASARQAALNGN