Protein Info for PP_1766 in Pseudomonas putida KT2440

Annotation: methylthioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase
  • amino acids 13 to 341 (329 residues), 410.3 bits, E=5.5e-127
• TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins
  • amino acids 38 to 341 (304 residues), 306 bits, E=2.6e-95
• PF01008: IF-2B
  • amino acids 53 to 341 (289 residues), 229.8 bits, E=2.1e-72

Best Hits

Swiss-Prot: 100% identical to MTNA_PSEPK: Methylthioribose-1-phosphate isomerase (mtnA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 100% identity to ppu:PP_1766)

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

• 5'-deoxyadenosine degradation II (2/4 steps found)
• 5'-deoxyadenosine degradation I (1/3 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (2/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (5/12 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

See Q88M09 at UniProt or InterPro

Protein Sequence (358 amino acids)

>PP_1766 methylthioribose-1-phosphate isomerase (Pseudomonas putida KT2440)
MRERLLAAEKVTAIRWQGGALHLLDQRLLPSEERWLACDNVAQVAAAIRDMAVRGASAIG
IAAAYGLVLALEERLAEGGDWEMDLEDDFLTLAEARPTAANLFWALNRMRERLLCLRPEE
DVLAALEAEAVAIHDSDREANLTMAQQGIELIRRHQGNAQALLTFGNAGALASGGFGTAL
GVIRAGYLEGMVERVYAGETRPWLQGSRLTGWELANEGIPVTLCADSALAHLMKTKGITW
VVVGADCIAANGDMAGKIGTYQLAVSAMHHGVRFMVVAPSTSIDLNLATGEDIPLEERDA
DEWLDFGGTPVSPGVEVFNPVFDVTPADLIDVIVTERGIVERPDAAKLAQLVCRKRLH