Protein Info for PP_1761 in Pseudomonas putida KT2440

Annotation: diguanylate cyclase with phosphodiesterase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 841 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 266 to 389 (124 residues), 47.4 bits, see alignment E=2e-16 PF00989: PAS" amino acids 274 to 383 (110 residues), 44.7 bits, see alignment E=3e-15 PF08448: PAS_4" amino acids 275 to 388 (114 residues), 37.6 bits, see alignment E=5.7e-13 PF13426: PAS_9" amino acids 279 to 385 (107 residues), 37.7 bits, see alignment E=5.3e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 393 to 557 (165 residues), 143.3 bits, see alignment E=6e-46 PF00990: GGDEF" amino acids 397 to 554 (158 residues), 152.6 bits, see alignment E=2.1e-48 PF00563: EAL" amino acids 576 to 814 (239 residues), 205.1 bits, see alignment E=2.8e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1761)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M14 at UniProt or InterPro

Protein Sequence (841 amino acids)

>PP_1761 diguanylate cyclase with phosphodiesterase domain (Pseudomonas putida KT2440)
MANGLRCACLGRFTPYLLCDRDSMKGHRTLEAPKLLGITWPFIAVVVLQVALGSLSLYTL
SAVRAYVAGESLWSKAQKDAIYYLSLYGETQDDSTYQRYRQAITVPQGDHRLREVLDHPS
PDLNAARQAVLQGGNHPDDVDRIIWFYRNFRHVSYMQTAIDYWDIGDDYLAKLDVLAGEM
RQRFANGPADPDTVSDWKARIVAINEGVTPAAKAFSDALGEGSRMLLRVLLITNLLTAMF
LIAIAWRRSSKLLAQRQAFASALQEEKERAQITLQAIGDAVITTDVEGNIGYMNPAAEQL
THWQSGQAQGLPLSALFSLVDEHAEEDGRSLVEQVLSGSLKGGSEHARLIQRLDGSTVSI
NLVGSPILNDGQVSGIVLVLHDMTQERQYIANLSWQATHDALTGLANRREFEYRLEQALN
DLARQAGRHSLMFLDLDQFKLVNDTCGHAAGDELLRHICAVLQSGLREGDTLARLGGDEF
GVLLENCPPDQAERIGEQLRQMVQSLHFVWKGRPFVTTVSIGLVHMAQAPGTLEASLRAA
DMACYMAKEKGRNRVQVYHADDSELSMRFGEMAWIQRLHVALEENRFCLYAQEIAPLKTF
EGPGHIEILLRLHDESGRTILPSSFIPAAERYGLMTALDRWVVRNVFMVIRKCLEEGREG
PLSTCAINLSGSSIGDDKFLEYLQRLFVEYAIPPRMICFEITETSAIANLGSAIRFINEL
KGLGCRFSLDDFCAGMSSFAYLKHLPVDYLKIDGSFVKDMLDDPVNRAMVEVINHIGHVM
GKRTIAEFVETPLIEQALQEIGVDYAQGYLIERPQVFTCDSLQRQRIAARPLLQRAPGTF
R