Protein Info for PP_1757 in Pseudomonas putida KT2440

Annotation: DNA-binding transcriptional dual regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 PF01722: BolA" amino acids 12 to 80 (69 residues), 89.5 bits, see alignment E=7e-30

Best Hits

Swiss-Prot: 48% identical to BOLA_VIBAL: DNA-binding transcriptional regulator BolA (bolA) from Vibrio alginolyticus

KEGG orthology group: K05527, BolA protein (inferred from 98% identity to ppw:PputW619_1364)

Predicted SEED Role

"Cell division protein BolA" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M18 at UniProt or InterPro

Protein Sequence (98 amino acids)

>PP_1757 DNA-binding transcriptional dual regulator (Pseudomonas putida KT2440)
MTMQQRIEQQLAALAPQHLEVLNESHMHSRGQETHYKAVIVSEQFAGLNSVKRHQKVYAT
MGELMGEIHALAIHTYTAEEWAKVGVAPASPVCAGGGH