Protein Info for PP_1751 in Pseudomonas putida KT2440

Annotation: methyltransferase/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 PF05430: Methyltransf_30" amino acids 113 to 234 (122 residues), 136.9 bits, see alignment E=1.1e-43 PF01494: FAD_binding_3" amino acids 258 to 294 (37 residues), 25 bits, see alignment 3.3e-09 PF01266: DAO" amino acids 259 to 624 (366 residues), 169.3 bits, see alignment E=5.5e-53 PF00890: FAD_binding_2" amino acids 259 to 290 (32 residues), 20.8 bits, see alignment (E = 6e-08) TIGR03197: tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain" amino acids 259 to 653 (395 residues), 448.9 bits, see alignment E=9e-139 PF13450: NAD_binding_8" amino acids 261 to 295 (35 residues), 27.9 bits, see alignment (E = 7.2e-10)

Best Hits

Swiss-Prot: 100% identical to MNMC_PSEPK: tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC (mnmC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1751)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M24 at UniProt or InterPro

Protein Sequence (654 amino acids)

>PP_1751 methyltransferase/FAD-dependent oxidoreductase (Pseudomonas putida KT2440)
MPTLLQHAQIDWDDQGRPHSRHYDDVYFAVNEGIEETKHVFLGQTRLAERFANLAPHACT
VIGETGFGTGMNFFCAWQLFDQHAHSDARLHFVSVEKYPLDHADMARAVRLWPELAAYTE
PLLEQYVAVHPGFQQFTFTGGRVTLTLLIGDVLEQLPQLDAQIDVWFLDGFAPAKNPDMW
TPELFAQLARLSHPGTVLGTFTTTGWVRRSLVEAGFAMKKVPGIGKKWEVMSGAYVGPLP
GPCAPWYARPAVTQGPREALVIGAGLAGSSSAASLARRGWQVTVLERHEAPAQEASGNPQ
GVLYLKLSAHGTALSQMILSGFGYTRRQLQRLQRGRDWDACGVLQLAFDSKEAERQGKLA
AAFDPGLLHCLARAEAEAIAGVALPGGGLFYPEGGWVHPPALCQQQLQHPGIHLVTHQEV
LELRKVDEQWQAWAGDQLLARAPVVVLAGAADVLRFEPCAQLPLKRIRGQITRLPATVSS
QALRTVVCAEGYVAPPREGEHTLGASFDFHSEDLAPTVAEHQGNLALLDEISVDLAQRLA
VAELDPEQLQGRAAFRCTSPDYLPIVGPIADAQAFAEAYAVLGRDARQVPDVPCPWLGGL
YVNSGHGSRGLITAPLSGELVAAWVCGEPLPLPRAVAQACHPNRFGLRRLIRGK