Protein Info for PP_1734 in Pseudomonas putida KT2440

Annotation: Probable septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR01222: septum site-determining protein MinC" amino acids 37 to 275 (239 residues), 269.6 bits, see alignment E=1.2e-84 PF05209: MinC_N" amino acids 38 to 109 (72 residues), 68.2 bits, see alignment E=5.4e-23 PF03775: MinC_C" amino acids 171 to 272 (102 residues), 106.8 bits, see alignment E=5.3e-35

Best Hits

Swiss-Prot: 100% identical to MINC_PSEPK: Probable septum site-determining protein MinC (minC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 100% identity to ppu:PP_1734)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M41 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PP_1734 Probable septum site-determining protein MinC (Pseudomonas putida KT2440)
MHVAGNRCSRYKSGHFFRNKPSMQTMSPNHTPDTASVFQLKGSMLAITVLELARNDLEAL
DRQLAAKVAQAPNFFSNTPLVLALDKLPADEGAIDLPGLMRICRHHGLRTLAIRANRIED
IAAAIAIDLPVLPPSGARERPLEPEPEVVKKPEPAPAPPPPPEPEVRPTRIITSPVRGGQ
QIYAQGGDLVVTASVSPGAELLADGNIHVYGAMRGRALAGIKGNTKARIFCQQMTAEMVS
IAGQYKVCEDLRRDPLWGTSVQVSLSGDVLNITRL