Protein Info for PP_1726 in Pseudomonas putida KT2440

Annotation: ABC transporter, periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13416: SBP_bac_8" amino acids 62 to 313 (252 residues), 55.5 bits, see alignment E=1.2e-18 PF13343: SBP_bac_6" amino acids 92 to 317 (226 residues), 104.2 bits, see alignment E=1.2e-33 PF13531: SBP_bac_11" amino acids 136 to 291 (156 residues), 37.7 bits, see alignment E=2.9e-13

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 99% identity to ppf:Pput_3993)

Predicted SEED Role

"ABC-type Fe3+ transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M48 at UniProt or InterPro

Protein Sequence (354 amino acids)

>PP_1726 ABC transporter, periplasmic binding protein (Pseudomonas putida KT2440)
MKKFFMASLLGSAIALCTTAMAASTDLKALEDAARKEGTVNSVGMPDAWANWKGTWEDLA
SKYGLKHSDTDMSSAQELAKFEAEKDNASADIGDVGAAFGPIAVTKGVSQPYKPSTWDQV
PEWAKDKDGHWALAYTGTIAFIINKDLVKEEERPKTWHDLEKGKYKVAIGDVGTAAQAAN
GVLAAAIAYKGDESNVAPGLQLFTKLAQQKRLSLANPTIQTLEKGEVEVGVVWDFNGLSY
REQIDPKRFEVLIPSDGSVISGYTTVINKYAKHPNAAKLTREYIFSDAGQINLAKGHARP
IRAEHLKLPADVQAKLLPNDQYAAAQPIKNAEAWEATSKKLPQMWQEQVIIEME