Protein Info for PP_1710 in Pseudomonas putida KT2440

Annotation: MFS transporter, phthalate permease family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 289 to 314 (26 residues), see Phobius details amino acids 326 to 343 (18 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 381 to 406 (26 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 399 (365 residues), 182.2 bits, see alignment E=7.1e-58 TIGR00893: D-galactonate transporter" amino acids 37 to 433 (397 residues), 395.7 bits, see alignment E=1.1e-122

Best Hits

Swiss-Prot: 44% identical to DGOT_ECOL6: D-galactonate transporter (dgoT) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1710)

MetaCyc: 44% identical to D-galactonate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-16

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M64 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PP_1710 MFS transporter, phthalate permease family (Pseudomonas putida KT2440)
MSSTPTPRAASSYTLDAAPAQRLPTRRRWFMLSLLLVATIINYVDRVNISIAAPFMAKDL
GLDKVEMGLIFSAFAWTYALALVPAGFIADRFGSRLTYGVSLISWSAVTVAQGLASGFAS
LFGLRLAVGAMEAPAFPANSRAVTVWFPARERGMASSIYVCGQYLGTALFTGALLWLATT
YDWRHVFYSTGLVGILFGVVWLVLYRDPLNCKKVSKEELAYIENGGGLVKSSQERTRFDW
RQVAELFRYRQVWAICLGKFASTSALYFFLTWFPTYLIEERQLTLIKVGIFAVMPFIGAT
VGILLAGIVSDLLIRKGYSLSFARKLPLVVGSMLGMSIVLVNFTDSNVLCIAVLTLAFFA
QGIASSSWAAVSEVAPKELIGLTGGITSLAANIGGIVTPIVIGAIVHASGSFAMAFWFIG
GVALMGTLSYSLLLGKLYRIELKTAG