Protein Info for PP_1702 in Pseudomonas putida KT2440
Annotation: Recombination-associated protein RdgC
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RDGC_PSEPK: Recombination-associated protein RdgC (rdgC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
KEGG orthology group: K03554, recombination associated protein RdgC (inferred from 99% identity to ppg:PputGB1_1300)Predicted SEED Role
"DNA recombination-dependent growth factor C" in subsystem CBSS-562.2.peg.5158 SK3 including or DNA repair, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88M72 at UniProt or InterPro
Protein Sequence (306 amino acids)
>PP_1702 Recombination-associated protein RdgC (Pseudomonas putida KT2440) MWFKNLLTYRLTQEVPFEPEALEAALASKPARPCASQELTTYGFVAPFGKGEDAPLVHVS GEYLLIAARKEERILPSSVVNDAVKEKVEEIETEQMRKVYKKERDQIKDEIIQAFLPRAF IRRSMIFAAIAPRLGVILVNSASAKRAEDLLSTLREVMGSLPVRPATVKIAPVATMTDWV KSQQAAEGFYVLDECELRDTAEDGGIVRCKRQDLTGEEIQLHLSTGKVVTQLALAWQDKL SFILDDKMVIKRLKFEELLQEQAEQDGGDEAAQQFDASFQLMMMTFAEFLPVLFEALGGE EIPQGV