Protein Info for PP_1695 in Pseudomonas putida KT2440

Annotation: putative Sodium-solute symporter/sensory box histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1159 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 190 to 216 (27 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 328 to 354 (27 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details amino acids 411 to 433 (23 residues), see Phobius details amino acids 441 to 465 (25 residues), see Phobius details amino acids 489 to 511 (23 residues), see Phobius details PF13188: PAS_8" amino acids 637 to 685 (49 residues), 20.5 bits, see alignment (E = 8.7e-08) PF12860: PAS_7" amino acids 642 to 756 (115 residues), 146.6 bits, see alignment E=8.1e-47 PF00512: HisKA" amino acids 797 to 863 (67 residues), 51.3 bits, see alignment 2.4e-17 PF02518: HATPase_c" amino acids 909 to 1016 (108 residues), 75.2 bits, see alignment E=1.4e-24 PF00072: Response_reg" amino acids 1040 to 1151 (112 residues), 39.4 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1695)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M79 at UniProt or InterPro

Protein Sequence (1159 amino acids)

>PP_1695 putative Sodium-solute symporter/sensory box histidine kinase/response regulator (Pseudomonas putida KT2440)
MSLSSGLIAVVALAYMAIMFAIAFYGDRRSTPLPPKLRAWVYSLSLAVYCTSWTFFGAVG
QAAEQLWAFLPIYLGPVLLLIFAPWVLQKMVLISKQQNITSIADFIAARYGKSQTLAVVV
ALICLVGVLPYIALQLKGIVLGVNLLIGANADATGTRVQDTALVISLVLALFAIVFGTRS
LDVTEHHRGMVLAIAFESLIKLLAFLAVGIFIVFNLFDGFDDLFSQARQSIHLQDYWKET
INWPSMVVQTAVAMMAIICLPRQFHVTVVENIEPQDLRLARWVFPMYLALAALFVVPIAL
AGQMLLPGTVISDSFVISLPLAEAHPSLALLAFIGGASAATGMVIVEAVALSTMVSNDML
LPWLLRRNNAERPFEAFRHWMLSVRRVTIVVILLLAYVSYRLLGSTASLATIGQIAFAAV
TQLTPAMLGALYWKQANRRGVFAGLAAGIFLWFYTLVLPIAAHSLGWSLQLFPGLAWLHG
NPLNLPISPLTQGVVLSLAGNFTLFAWVSVLSRTRVSEHWQAGRFIGQQTSARPSSKPLL
AVQIDDLLTLASRFVGEERARQSFIRFAYRQGKGFNPNQNADGDWIEHTERLLAGVLGTS
STRAVVKAAIEGRDMQLEDVVRIADEASEVLQFNRALLQGAIENINQGISVVDQNLHLVA
WNRRYLELFNYPDGLISVGRPIADIIRYNAERGLCGPGEAQVHVARRLHWMRQGRAHSSE
RLFPNGRVIELIGNPMPGGGFVMSFTDITPFREAEQALRDANERLEQRVAERTHELSQLN
QALSEAKSQAEAVSNSKTRFLAAVSHDLMQPLNAARLFSAALSQQAEGMNEEARQLVQHM
DSSLRSAEELISDLLDISRLENGKITPDAKPFALNELFDTLGAEFKLLAAEKGLEFRLRG
SRLRVDSDMKLLRRVLQNFLTNALRYGKSPILLGARRQGERLWLEVWDRGPGIADDKLQV
IFQEFKRLDSHQTRAEKGLGLGLAIADGLCRVLGHPLEVRSWPGKGTVFRVSVPIARQAA
AAPSTPVEQQGGQPLAGLQVLCVDNEDSILIGMNSLLSRWGCQVWTARNQAECEALLAKG
MRPHLALVDYHLDDGETGTGLMGWLRARLGEPVPGVVISADGSKETIALVHASGLDYLAK
PVKPAALRALLNRHLSLAQ