Protein Info for PP_1673 in Pseudomonas putida KT2440

Annotation: cobyrinate a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00379: cobyrinic acid a,c-diamide synthase
  • amino acids 10 to 429 (420 residues), 265.5 bits, E=4.5e-83
• PF01656: CbiA
  • amino acids 11 to 188 (178 residues), 47 bits, E=2.4e-16
• PF07685: GATase_3
  • amino acids 240 to 418 (179 residues), 111.5 bits, E=4.1e-36

Best Hits

Swiss-Prot: 76% identical to COBB_PSEU5: Hydrogenobyrinate a,c-diamide synthase (cobB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 100% identity to ppu:PP_1673)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

See Q88MA1 at UniProt or InterPro

Protein Sequence (431 amino acids)

>PP_1673 cobyrinate a,c-diamide synthase (Pseudomonas putida KT2440)
MSRSRHCPAVLIAAPASGQGKTTVTAALARLHRNLGRKVRVFKCGPDFLDPMILERASGA
PVYQLDLWMIGAEESRRLLWEAAGEADLILIEGVMGLFDGTPSSADLARHFGVPVLAVID
GTAMAQTFGALALGLARYQADLPFAGVLANRVGSLRHAQLLEGSLTEGLRWYGGLSRERG
IELPSRHLGLVQASELNDLDTRLDAAAEALGASCDAALPPPVSFAEPEPQACVASLAGVR
IGVARDEAFAFIYGANLDLLRNLGAQLVFFSPLHDHELPAVDSLYLPGGYPELHHHALAA
NAPMCEAIRAHHAQGKPLLAECGGMLYLLDALTDVAGERAELLGLLPGEATMQKRLAALA
LQAVELPEGTLRGHTYHHSLTSTALEPIARGLSPNGGRGNEAVYRLGRLTASYVHFYFPS
CPDAAAALLRP