Protein Info for PP_1672 in Pseudomonas putida KT2440

Annotation: cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF12557: Co_AT_N" amino acids 1 to 26 (26 residues), 39.8 bits, see alignment (E = 3.3e-14) TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase" amino acids 31 to 202 (172 residues), 212.9 bits, see alignment E=1.4e-67 PF02572: CobA_CobO_BtuR" amino acids 34 to 202 (169 residues), 216.2 bits, see alignment E=3.7e-68

Best Hits

Swiss-Prot: 76% identical to COBO_PSEAE: Corrinoid adenosyltransferase (cobO) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 100% identity to ppf:Pput_4047)

MetaCyc: 49% identical to CobO (Pseudomonas denitrificans (nom. rej.))
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MA2 at UniProt or InterPro

Protein Sequence (203 amino acids)

>PP_1672 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase (Pseudomonas putida KT2440)
MSDSTERDERHLARMQRKKAVIDERIANSPNECGLLLVLTGNGKGKSSSAFGMLARALGH
GMQCGVVQFIKGRNSTGEELFFRRFPEQVRYHVMGEGFTWETQDRQRDIAAAQAAWAVSR
QLLQDPGVQFVVLDELNIALKHGYLDLDQVLSDIQARPPMQHVIVTGRAAKPEMIELADT
VTEMGMLKHAFQAGIRAQKGVEL