Protein Info for PP_1652 in Pseudomonas putida KT2440

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 153 to 179 (27 residues), see Phobius details PF16750: HK_sensor" amino acids 39 to 148 (110 residues), 138 bits, see alignment E=3e-44 PF00672: HAMP" amino acids 175 to 228 (54 residues), 38.7 bits, see alignment 2e-13 PF00512: HisKA" amino acids 234 to 292 (59 residues), 45.8 bits, see alignment E=1e-15 PF02518: HATPase_c" amino acids 339 to 445 (107 residues), 74.8 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 53% identical to PFES_PSEAE: Sensor protein PfeS (pfeS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1652)

Predicted SEED Role

"Two-component sensor histidine kinase PfeS, enterobactin" in subsystem Siderophore Enterobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MC1 at UniProt or InterPro

Protein Sequence (458 amino acids)

>PP_1652 histidine kinase (Pseudomonas putida KT2440)
MLDRHSLFWKLAILLVGFCLLMIGLSYTWGRHMETQNAFLSEPARQTLRGYAAEAEQAWR
SGGRAGLDQWVAAMHQRERGWVGVLDINLRPLDSATLNPQIMQRLTRLRGVDWPMSRRSV
DQPWVRIPFPGAPEQGMLVIELPQRFNPGQHRLLWRIVTNGIIPGLFTLLLCVGLYRMLI
VPLNQLREQANAWRADQLSARLDSRTIARHDELGELARAFDQMAERLQGTVAMQQQLLRD
LSHEMRTPLSRLRVACDGETDLQRLRDRLIREVDCMQQLVEDTLQLAWQDAERAPMNLEP
IEVHALWELLAENASYESGWSPAQLRCEVPADCWVQGNLNHLAQALENILRNAIRHSPAE
GVVRLGGQREGSYWWLWLEDEGGGVAEEDLERIFAPFSRLDGSRPGDGGFGLGLSIARSA
IQRQGGTLWAQNGKRGLRLWMRLPLHVPASSRVNPLVW