Protein Info for PP_1620 in Pseudomonas putida KT2440

Annotation: 5'(3')-nucleotidase and polyphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00087: 5'/3'-nucleotidase SurE
  • amino acids 1 to 232 (232 residues), 209.1 bits, E=3.7e-66
• PF01975: SurE
  • amino acids 3 to 181 (179 residues), 193.7 bits, E=1.4e-61

Best Hits

Swiss-Prot: 100% identical to SURE_PSEPK: 5'-nucleotidase SurE (surE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 99% identity to ppg:PputGB1_1174)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5) @ Exopolyphosphatase (EC 3.6.1.11)" (EC 3.1.3.5, EC 3.6.1.11)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• ureide biosynthesis (6/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• polyphosphate metabolism (2/2 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• NAD salvage (plants) (4/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5, 3.6.1.11

Use Curated BLAST to search for 3.1.3.5 or 3.6.1.11

Sequence Analysis Tools

See Q88MF1 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PP_1620 5'(3')-nucleotidase and polyphosphatase (Pseudomonas putida KT2440)
MRILISNDDGVTAPGIAALHAALADYAECAVIAPDQDKSGASSSLTLDRPLHPQTLANGF
ISLNGTPTDCVHLGLNGLLPQMPDMVVSGINLGANLGDDVLYSGTVAAALEGRFLGGTSL
AFSLLSRQPDNLPTAAYIARRLVEAQSRLVLPPRTVLNVNIPNLPLEHIRGIQLTRLGHR
ARAAAPTKVVNPRGKEGYWIAVAGDAEDGGPGTDFHAVMQGYVSITPLQLDRTFNDAFEQ
LDGWLEGLL