Protein Info for PP_1597 in Pseudomonas putida KT2440

Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase" amino acids 14 to 397 (384 residues), 510.5 bits, see alignment E=1.4e-157 PF02670: DXP_reductoisom" amino acids 15 to 143 (129 residues), 152.1 bits, see alignment E=2e-48 PF08436: DXP_redisom_C" amino acids 157 to 245 (89 residues), 128.3 bits, see alignment E=1.5e-41 PF13288: DXPR_C" amino acids 277 to 393 (117 residues), 148.9 bits, see alignment E=1.1e-47

Best Hits

Swiss-Prot: 100% identical to DXR_PSEPK: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 100% identity to ppu:PP_1597)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MH4 at UniProt or InterPro

Protein Sequence (404 amino acids)

>PP_1597 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Pseudomonas putida KT2440)
MGCRMGCDVSRPQRITVLGATGSIGLSTLDVIARHPDRYQAFALTGYSRIDELLALCVRH
RPAFAVVPSTEAAVRLRASLAAAGCTTEVLEGEAGLCQVASAAEVDAVMAAIVGAAGLRP
TLAAVEAGKKVLLANKEALVMSGALFMEAVRQKGAVLLPIDSEHNAIFQCMPGDYARGLS
AVGVRRILLTASGGPFRETPVEALLDVTPEQACAHPNWSMGRKISVDSASMMNKGLELIE
ACWLFDAVPSKVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGV
APLDLFAIARLDFQAPDEQRFPCLRLARQAAEAGNSAPAVLNAANEVAVQAFLERRIRFP
EIAGMIEQVLDQEPVVPLPSLDAVFAADQRARELSREWLRRHGR