Protein Info for PP_1471 in Pseudomonas putida KT2440

Annotation: Threonine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF14821: Thr_synth_N" amino acids 2 to 80 (79 residues), 104.2 bits, see alignment E=4.9e-34 TIGR00260: threonine synthase" amino acids 69 to 430 (362 residues), 276.3 bits, see alignment E=1.9e-86 PF00291: PALP" amino acids 93 to 402 (310 residues), 87.9 bits, see alignment E=1.2e-28 PF24857: THR4_C" amino acids 387 to 459 (73 residues), 88.9 bits, see alignment E=3e-29

Best Hits

Swiss-Prot: 89% identical to THRC_PSEAE: Threonine synthase (thrC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 100% identity to ppg:PputGB1_1076)

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.3.1

Use Curated BLAST to search for 4.2.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MU7 at UniProt or InterPro

Protein Sequence (469 amino acids)

>PP_1471 Threonine synthase (Pseudomonas putida KT2440)
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVEGSIADADFKKILEETYGEFAHAAVAPLRQLNSNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRNERVVIIGATSGDTGSAAIEGCRRCDNVDIFILHPHQRVSEVQRRQMTTI
FGDNIHNIAIEGNFDDCQEMVKASFADQSFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDLHGRNGGAIAELMANFKQGGGFSVEQDRWTEARKLFDS
LAVSDEQTCETIAEVFAATGEVLDPHTAIGVKAARECRRSLDTPMVVLGTAHPVKFPEAV
EKAGVGKALELPAHLSDLFSREERCTVLANDLKAVQGFVSQHGNRGKPL