Protein Info for PP_1468 in Pseudomonas putida KT2440

Annotation: Tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF02899: Phage_int_SAM_1" amino acids 9 to 91 (83 residues), 71.3 bits, see alignment E=6.6e-24 TIGR02225: tyrosine recombinase XerD" amino acids 10 to 297 (288 residues), 387.9 bits, see alignment E=1.5e-120 PF00589: Phage_integrase" amino acids 113 to 285 (173 residues), 189.6 bits, see alignment E=3.9e-60

Best Hits

Swiss-Prot: 100% identical to XERD_PSEPK: Tyrosine recombinase XerD (xerD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 100% identity to ppf:Pput_4253)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MV0 at UniProt or InterPro

Protein Sequence (298 amino acids)

>PP_1468 Tyrosine recombinase XerD (Pseudomonas putida KT2440)
MPALDHPLIDQFLDALWLEKGLSDNTRVSYRSDLALFNGWLQEHSVSLPDAGRDLILDHL
AWRLDQGYKPRSTARFLSGLRGFFRYLLREKLVAIDPTLQVDMPQLGKPLPKSLSEADVE
ALLQAPDLGEAIGQRDRAMLEVLYACGLRVTELVSLTLDQVNLRQGVLRVMGKGSKERLV
PMGEEAVVWLERYQRDGRAELLNGRPSDVLFPSQRGEQMTRQTFWHRIKHHARVAGIDKP
LSPHTLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVAKARLQQLHAQHHPRG