Protein Info for PP_1467 in Pseudomonas putida KT2440

Annotation: NhaP-type Na+(K+)/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 274 to 290 (17 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 16 to 390 (375 residues), 133.8 bits, see alignment E=3.7e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1467)

Predicted SEED Role

"Sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MV1 at UniProt or InterPro

Protein Sequence (601 amino acids)

>PP_1467 NhaP-type Na+(K+)/H+ antiporter (Pseudomonas putida KT2440)
MSEQQILLSVGGIGAAALACQWLAWRLKLPAILFLLLAGILAGPALGWLDPEALFGPLLM
PLVSLSVALILFEGSLTLHLSQWREIGSVVHRLVTVGALVTWLVIALATHWLLGFDWPLA
ILFGTLTLVTGPTVIVPMLRVVRPKAAIANILRWEGIMIDPIGALLAVVVYSFIIASAEG
NGLSQSLITFAGVLFCGTTLGAAGGWLLGQIMREQWLPEYLHNLASLAAVLGIFIAANQI
MHESGLLAVTVMGMWLANMRGVDVRQILHFKENLSVLLISGLFILLAARLDLHALLGLGP
AVLALLLVIQLLARPLNVWLATLGSTLNWRERALLAWIAPRGIVAAAVSAIFAIRLHQAG
HQDALLLVPLTFAVIIGTVVLQSATARPLARLLKVAEPAPSGFLVVGANEPARAIAKALQ
HLGCRVLLTDSSWENIRAARMDGLTTYFGNPASQHADAHLDLVGLGHLLGLSPAGEINAL
ACARFRHDFGHSRLFVLASGLEKQRSDKHRAAEEHRGHLLGAKPMTYLQLANRLHQGAEL
YSTNLTEGFGWDAYQALHGERAHLLFARDGQGWVHVASPDNPLQPQPGWTLVALIEPAPE
P