Protein Info for PP_1440 in Pseudomonas putida KT2440

Annotation: tRNA (mo5U34)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 8 to 318 (311 residues), 478.1 bits, E=2.7e-147
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 9 to 317 (309 residues), 459.8 bits, E=1.8e-142
• PF13489: Methyltransf_23
  • amino acids 116 to 266 (151 residues), 46.9 bits, E=6.4e-16
• PF13649: Methyltransf_25
  • amino acids 122 to 216 (95 residues), 27.6 bits, E=9.7e-10
• PF08241: Methyltransf_11
  • amino acids 123 to 220 (98 residues), 28.2 bits, E=6.1e-10

Best Hits

Swiss-Prot: 100% identical to CMOB_PSEPK: tRNA U34 carboxymethyltransferase (cmoB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 99% identity to ppf:Pput_4281)

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q88MX8 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PP_1440 tRNA (mo5U34)-methyltransferase (Pseudomonas putida KT2440)
MIDLSPLVRRLAGTPLASWSQGLQAQLDAKLEKGHGDLDRWRGALEALPALQPSEIDLVN
GLRLDCDCDDATRAQMRQALMGLSPWRKGPFDLFGVHVDTEWRSDWKWSRVGPHLDLQGK
RVLDVGCGNGYYQWRMLGAGADMVIGVDPNWLFFCQFQAVQQYLPELPAWHLPFALEDLP
ANLEGFDTVFSMGVFYHRRSPIEHLLALKDCLVKGGELVLETLVIEGDENQVLVPEDRYA
QMRNVWYLPSVPALARWLRRAGFSDVRCVDVSVTSVEEQRSTDWMRYQSLSDFLDPNDHS
KTVEGLPAPRRATLLARK