Protein Info for PP_1430 in Pseudomonas putida KT2440

Annotation: putative periplasmic serine endoprotease DegP-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details TIGR02037: peptidase Do" amino acids 48 to 488 (441 residues), 547 bits, see alignment E=1.6e-168 PF00089: Trypsin" amino acids 113 to 270 (158 residues), 69.3 bits, see alignment E=1.3e-22 PF13365: Trypsin_2" amino acids 116 to 249 (134 residues), 134.5 bits, see alignment E=1.5e-42 PF00595: PDZ" amino acids 284 to 345 (62 residues), 42.5 bits, see alignment E=2.1e-14 amino acids 399 to 462 (64 residues), 29.9 bits, see alignment E=1.8e-10 PF13180: PDZ_2" amino acids 290 to 379 (90 residues), 57 bits, see alignment E=6e-19 amino acids 404 to 485 (82 residues), 34.9 bits, see alignment E=4.5e-12 PF17820: PDZ_6" amino acids 315 to 367 (53 residues), 39.7 bits, see alignment 9.7e-14 amino acids 427 to 479 (53 residues), 29.4 bits, see alignment 1.5e-10

Best Hits

Swiss-Prot: 99% identical to DEGPL_PSEP1: Probable periplasmic serine endoprotease DegP-like (Pput_4291) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to ppu:PP_1430)

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MY8 at UniProt or InterPro

Protein Sequence (492 amino acids)

>PP_1430 putative periplasmic serine endoprotease DegP-like (Pseudomonas putida KT2440)
MQGSFQTTARCDGSRMSIPRLKSYLMMFAAVLMLGQVVAAQAEEALPDFTTLVEQASPAV
VNISTKQKLPDRRIAANQMPDLEGLPPMFREFFERNMPQQPRSPRGDRQREAQSLGSGFI
ISSDGYVLTNNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKVDGKNLPTVKLGD
SEKLKVGEWVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLF
NMKGEVVGINSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKD
LAESFGLDKPAGALVAQVLENGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGGLKDGE
KAKLEIIRNGKRQNLDISVGALPDDDVDIGAGTEGSAERSSNRLGVSVADLTAEQKKSLE
LKGGVVIKEVQDGPAAMIGLRPGDVISHLNNQAIGSAKEFTEIAKELPKNRSVSMRVLRQ
GRASFITFKLAE