Protein Info for PP_1415 in Pseudomonas putida KT2440

Annotation: putative membrane associated enzyme subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 10 to 164 (155 residues), 131.3 bits, see alignment E=1.3e-42 amino acids 182 to 338 (157 residues), 139.3 bits, see alignment E=4.9e-45 PF05145: AbrB" amino acids 32 to 338 (307 residues), 299 bits, see alignment E=1.8e-93

Best Hits

KEGG orthology group: K07120, (no description) (inferred from 100% identity to ppu:PP_1415)

Predicted SEED Role

"Ammonia monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N03 at UniProt or InterPro

Protein Sequence (351 amino acids)

>PP_1415 putative membrane associated enzyme subunit (Pseudomonas putida KT2440)
MPDRSLPLFVATGLVGLAGGFAASKVGWPLPWMVGSLLAIILVRCLTRWQLSEIPNGRKC
GQWIIGIGIGLHFTPAVIEQVASHFALIFFGALFTTLSSVISVWLLRRTGEDRATAFFAS
MPGGSGEMVNLGARNGAVLSQVAAAQSLRVLAVVLCVPALFKFLLGDGVPLNHTGSVSWG
WLALIAPLGVAVALLWQRLRQPNPWLFGPLLVAATVSLAGNLQIALPNGASQIGQWLIGS
GLACHFNRAFFRRAPSFLGRTLMATALCMAIAASAAWLLSMMTALDLRSLTLGMMPGGIA
EMSLTAETLQLSVPLVTALQVMRLILVLFLAEPLFRLWDNRHSSCKYPEDR