Protein Info for PP_1413 in Pseudomonas putida KT2440

Annotation: Uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR00628: uracil-DNA glycosylase" amino acids 11 to 218 (208 residues), 277.9 bits, see alignment E=3.2e-87 PF03167: UDG" amino acids 61 to 215 (155 residues), 63.1 bits, see alignment E=1.6e-21

Best Hits

Swiss-Prot: 100% identical to UNG_PSEPK: Uracil-DNA glycosylase (ung) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 100% identity to ppu:PP_1413)

MetaCyc: 57% identical to uracil-DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2584 [EC: 3.2.2.27]

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N05 at UniProt or InterPro

Protein Sequence (230 amino acids)

>PP_1413 Uracil-DNA glycosylase (Pseudomonas putida KT2440)
MTDDDRIKLEPSWKAALRGEFDQPYMHQLREFLRGEYAAGKEIYPPGPLIFNALNSTPLD
QVKVVILGQDPYHGPGQAHGLCFSVQPGVATPPSLVNIYKELQRDLNIPIPSHGYLQSWA
EQGVLLLNTTMTVERANAASHAKKGWELFTDRIIQVVSEQCPNVVFLLWGAHAQSKQKLI
DGTKHLVLKSVHPSPLSAYRGFIGCGHFSRANSFLEQRGLGPIDWALPPL