Protein Info for PP_1407 in Pseudomonas putida KT2440

Annotation: Sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 326 to 343 (18 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 382 to 410 (29 residues), see Phobius details amino acids 511 to 524 (14 residues), see Phobius details TIGR00815: sulfate permease" amino acids 8 to 547 (540 residues), 427.1 bits, see alignment E=5.1e-132 PF00916: Sulfate_transp" amino acids 21 to 388 (368 residues), 320.2 bits, see alignment E=1.6e-99 PF01740: STAS" amino acids 441 to 540 (100 residues), 60.3 bits, see alignment E=1.4e-20

Best Hits

Swiss-Prot: 40% identical to Y1739_MYCTO: Probable sulfate transporter MT1781 (MT1781) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1407)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N09 at UniProt or InterPro

Protein Sequence (568 amino acids)

>PP_1407 Sulfate transporter (Pseudomonas putida KT2440)
MFLSRWLPGLANLLHYRREWFHADLQAGLSVAAIQIPIAIAYAQIVGLPPQYGLYACVLP
MMVYALIGSSRQLMVGPDAATCAMIAGAVAPLAMGDPQRIVELSVIVTVLVGVMLIAAGL
ARAGFIASFFSRPILIGYLNGIGLSLIAGQLSKVVGFKIEGDGFILSLINFFQRLGEIHW
VTLIIGLAALGLLIWLPRRYPRLPAALTVVALFMLLVGLFGLDRFGVAVLGPVPAGIPQL
AWPHSNLAEMKSLLRDALGIATVSFCSAMLTARSFAARHGYAINANHEFVALGVSNLAAG
VSQGFAISGADSRTAVNDMVGGKSQLVGIIAALVIALILLFFTAPMAWIPQAALGAVLLM
AGWGLIDIKSLGHIRRLSRFEFWLCLLTTAGVLSLGVLPGIVFAVTLAILRLLYSIYQPT
DAVLGWLPGTEGQVDIRKFKDARTVPGLVVYRFDDAILFFNADYFKMRLLEAVQSQDQPK
AVLFDAEAVTSIDVSGIAALREVRDTLAAQGILFAIARARGTFLRMLVRSGMARDMEEKL
LFGSVRAGIRAYRVWRNRNRSVQVTEQG