Protein Info for PP_1401 in Pseudomonas putida KT2440

Annotation: C4-dicarboxylate transport transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 110.8 bits, see alignment E=1.4e-35 PF00158: Sigma54_activat" amino acids 145 to 310 (166 residues), 219 bits, see alignment E=1.1e-68 PF14532: Sigma54_activ_2" amino acids 145 to 315 (171 residues), 58.4 bits, see alignment E=3.6e-19 PF07728: AAA_5" amino acids 167 to 286 (120 residues), 22.1 bits, see alignment E=4.7e-08 PF25601: AAA_lid_14" amino acids 316 to 380 (65 residues), 61.5 bits, see alignment E=2e-20 PF02954: HTH_8" amino acids 393 to 432 (40 residues), 29.9 bits, see alignment 1.3e-10

Best Hits

Swiss-Prot: 52% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 100% identity to ppu:PP_1401)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N15 at UniProt or InterPro

Protein Sequence (444 amino acids)

>PP_1401 C4-dicarboxylate transport transcriptional regulatory protein (Pseudomonas putida KT2440)
MLNSVIVVDDEASIRTAVEQWLSLSGFSVELFARAEACLAHLPQHFPGVIISDVRMPGMD
GLQLLERLQANDPDLPVILLTGHGDVPMAVEAMRSGAYDFLEKPFTPQDLLGSLRRALEK
RQLVLENRRLHEQADLKSRLEGTLLGMSQGLQQLRRQVLDLAGLPVNVLIRGETGSGKER
VARCLHDFGPRAAKPFVALNCAAIPESLFEAELFGHESGAFTGAQGKRIGKLEYANGGTV
FLDEIESMPLAQQAKLLRVIQEQKLERLGANQSISVDLRIIAATKPDLLEEARAGRFRED
LAYRLNVAELRLAPLRERREDIPLLFEHFARAAGEKLGRAAPPLSGAQLAQLLSHDWPGN
VRELANAAERHALGLGSPNIEVAPAGQSLGEQMEAFEAQCLRAALRQHGGEIKSVMEALQ
LPRRTLNEKMQRHGLVREDFIGQA